PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA22566
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family NF-YC
Protein Properties Length: 110aa    MW: 12417.9 Da    PI: 4.2842
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA22566genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC461.1e-1430892585
                      NF-YC 25 rikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtr 85
                               + k i+k +edv+ i  e+  ++ kace fi ++t+rs l+++e+ r+t++ +d+  a+  
  Tp57577_TGAC_v2_mRNA22566 30 KSKEIMKEEEDVE-IPNETSDFIEKACEWFIKDITMRSMLKSNEAGRTTIEVNDVVGALGD 89
                               4589********7.899**************************************988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471133.59E-123292IPR009072Histone-fold
Gene3DG3DSA:1.10.20.105.7E-93393IPR009072Histone-fold
PfamPF008088.0E-83386IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
MDPHQKKNAE LVDKFGEEQF KKTGETADLK SKEIMKEEED VEIPNETSDF IEKACEWFIK  60
DITMRSMLKS NEAGRTTIEV NDVVGALGDI DFETKMKDEG TKVSPNKDD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48590.11e-09nuclear factor Y, subunit C1